PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g035530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 410aa    MW: 46191 Da    PI: 6.6838
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g035530.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.52.9e-104274062373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lLl+cA+a++s+d++la+++L+ l+++a pdgd++qRl++ f++AL +r ++++++l+++++  + +++ +  ++  l +f++++P+++f+++
  Csa04g035530.1  27 EQLLLHCATAIDSNDAALAHQILWVLNNTAPPDGDSTQRLTTAFLRALLSRAVSKTPTLSSTISFLPPADELHRFSVVELAAFVDLTPWHRFGFI 121
                     79*****************************************************************997666666666677************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl...vak 184
                     +aN aIl aveg ++vHi+D+++++++Q p+L++a+asR  ++pp l++T+v+s++++    + ++ee+g++L +fA++ ++++ef+++   +++
  Csa04g035530.1 122 AANAAILTAVEGYSTVHIVDLSLTHCMQIPTLIDAMASRLnKPPPLLKLTVVSSSDNFppfINISYEELGSKLVSFATTRNITMEFTIIpstYSD 216
                     ***************************************966777*********99999999**************************9886677 PP

            GRAS 185 rledleleeLrvkp...gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                      +++l l++Lrv p   +Eal+Vn++++l +++de+++++s   r+ +Lk ++sl+P++v+++e+++d++s+++++r+ +a++y +  fd++++ 
  Csa04g035530.1 217 GFSSL-LQQLRVYPssfNEALVVNCHMMLRYIPDETLTSSSssLRTVFLKHLRSLNPRIVTLIEEDVDLTSGNLVNRLRSAFNYLWIPFDTTDTF 310
                     78888.******************************998887799************************************************** PP

            GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLv 368
                     +    e+r+++E+e ++++i+nvva+egaer+er et+++W er++ea F+ v+++e+a++++k++l++++ ++g++ e++++slvl+Wk++++v
  Csa04g035530.1 311 M---REQRRWYEAE-ISWKIENVVAKEGAERVERSETKRRWFERMREAEFGGVRVKEEAVADVKAMLEEHAvGWGMKKEDDDNSLVLTWKGHSVV 401
                     6...99********.******************************************************************************** PP

            GRAS 369 svSaW 373
                     ++++W
  Csa04g035530.1 402 FATVW 406
                     ***** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.6041386IPR005202Transcription factor GRAS
PfamPF035141.0E-10127406IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MTKTRIRNLT RLPSPKPLRG GDANFMEQLL LHCATAIDSN DAALAHQILW VLNNTAPPDG  60
DSTQRLTTAF LRALLSRAVS KTPTLSSTIS FLPPADELHR FSVVELAAFV DLTPWHRFGF  120
IAANAAILTA VEGYSTVHIV DLSLTHCMQI PTLIDAMASR LNKPPPLLKL TVVSSSDNFP  180
PFINISYEEL GSKLVSFATT RNITMEFTII PSTYSDGFSS LLQQLRVYPS SFNEALVVNC  240
HMMLRYIPDE TLTSSSSSLR TVFLKHLRSL NPRIVTLIEE DVDLTSGNLV NRLRSAFNYL  300
WIPFDTTDTF MREQRRWYEA EISWKIENVV AKEGAERVER SETKRRWFER MREAEFGGVR  360
VKEEAVADVK AMLEEHAVGW GMKKEDDDNS LVLTWKGHSV VFATVWIPI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-19283736340GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2266230.0AK226623.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL07-29-K13.
GenBankAL1329780.0AL132978.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F3A4.
GenBankBT0125530.0BT012553.1 Arabidopsis thaliana At3g49950 gene, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010503664.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLR0FNR70.0R0FNR7_9BRAS; Uncharacterized protein
STRINGAT3G49950.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54452750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein